Loading...
Statistics
Advertisement

4oll.com

Advertisement
Conversion Technology Metas Server
4oll.com is hosted in United States / Provo . 4oll.com uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: nginx/1.10.1.

Technologies in use by 4oll.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • nginx/1.10.1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - 4oll.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by HostGator.com, LLC./OU=PositiveSSL Wildcard/CN=*.hostgator.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by HostGator.com, LLC.
        • 2: PositiveSSL Wildcard
      • CN: *.hostgator.com
    • hash: dd92202f
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 33731708412500954451172688233094812607
    • validFrom: 151016000000Z
    • validTo: 181015235959Z
    • validFrom_time_t: 1444953600
    • validTo_time_t: 1539647999
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 4B:D0:EA:16:17:0D:DC:C2:CF:F0:DB:13:1E:B2:1C:3B:57:B2:F2:16
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.hostgator.com, DNS:hostgator.com

Meta - 4oll.com

Number of occurences: 2
  • Name: robots
    Content: noarchive
  • Name: googlebot
    Content: nosnippet

Server / Hosting

  • IP: 50.87.144.144
  • Latitude: 40.22
  • Longitude: -111.61
  • Country: United States
  • City: Provo

HTTP Header Response

HTTP/1.1 200 OK Server: nginx/1.10.1 Date: Mon, 15 Aug 2016 16:08:26 GMT Content-Type: text/html X-Cache: MISS from s_fl343 X-Cache-Lookup: MISS from s_fl343:80 Transfer-Encoding: chunked Via: 1.1 s_fl343 (squid/3.5.9) Connection: keep-alive

DNS

host: 4oll.com
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 50.87.144.144

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.oll.com, www.4woll.com, www.woll.com, www.4qoll.com, www.qoll.com, www.4toll.com, www.toll.com, www.4eoll.com, www.eoll.com, www.4roll.com, www.roll.com, www.42oll.com, www.2oll.com, www.4ll.com, www.4obll.com, www.4bll.com, www.4ohll.com, www.4hll.com, www.4ogll.com, www.4gll.com, www.4ojll.com, www.4jll.com, www.4omll.com, www.4mll.com, www.4o ll.com, www.4 ll.com, www.4ovll.com, www.4vll.com, www.4ol.com, www.4olul.com, www.4oul.com, www.4ol8l.com, www.4o8l.com, www.4ol9l.com, www.4o9l.com, www.4oljl.com, www.4ojl.com, www.4ol0l.com, www.4o0l.com, www.4olml.com, www.4oml.com, www.4olpl.com, www.4opl.com, www.4olol.com, www.4ool.com, www.4ol.com, www.4ollu.com, www.4olu.com, www.4oll8.com, www.4ol8.com, www.4oll9.com, www.4ol9.com, www.4ollj.com, www.4olj.com, www.4oll0.com, www.4ol0.com, www.4ollm.com, www.4olm.com, www.4ollp.com, www.4olp.com, www.4ollo.com, www.4olo.com,

Other websites we recently analyzed

  1. Guide de l'entrepreneur individuel !
    France - 5.196.8.110
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 10
    Number of meta tags: 4
  2. accordoformazionesicurezza.it
    accordoformazionesicurezza.it
    France - 46.105.19.115
    Server software: Microsoft-IIS/7.5
    Technology: Html
    Number of meta tags: 4
  3. 843 Real Estate: Charleston South Carolina - Services
    Family owned Charleston SC Real Estate Agency providing residential sales and property management
    Houston (United States) - 108.167.135.120
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Google Font API, Html, Html5, Javascript
    Number of Javascript: 9
    Number of meta tags: 4
  4. GALAXY MACAU澳门银河国际
    GALAXY MACAU澳门银河国际
    India - 103.241.10.90
    G Analytics ID: UA-59062215-1
    Server software: Apache
    Technology: Html, Html5, Iframe, Php, Google Analytics
    Number of meta tags: 3
  5. Müzik Prodüksiyonu için ihtiyaçınız olan her şey!
    Müzik ve ses prodüksiyonu ile görsel sanatlar alanında ihtiyaçınız olan her şeye çözümler sunuyoruz.
    Bursa (Turkey) - 37.247.110.3
    Server software: LiteSpeed
    Technology: Carousel, CSS, Datepicker, Fancybox, Html, Html5, Javascript, jQuery, jQuery Cookie, JW Player, Php, Pingback, SVG, Google Analytics, Wordpress
    Number of Javascript: 13
    Number of meta tags: 10
  6. Indbovurdering
    Denmark - 81.19.232.68
    Server software: Apache SSD/Vfast 2.29ea
    Technology: CSS, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, WordPress Stats, Wordpress
    Number of Javascript: 9
    Number of meta tags: 3
  7. Nelson Clean Care For a Cleaner, Healthier Home
    Integrity and honesty are our foundation. Our years of experience equip us to guide our customers through a potentially emotional and crisis driven experience.
    Brea (United States) - 208.113.220.78
    Server software: Apache
    Technology: CSS, Google Font API, Html, Javascript, jQuery, Php, SuperFish, Swf Object, Google Analytics
    Number of Javascript: 7
    Number of meta tags: 4
  8. minipli.net
    Germany - 144.76.92.157
    Server software: Apache
    Technology: Html
  9. Yes You Can Recipes
    Recipes and tips for pre-diabetic and diabetic cookery
    Canada - 174.142.40.130
    Server software: Apache
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 4
    Number of meta tags: 3
  10. nancykhawamfamilylawandmediation.org
    United Kingdom - 81.21.76.62
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 1

Check Other Websites